PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g072990.1
Common NameMTR_8g072990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 243aa    MW: 26844.1 Da    PI: 6.9644
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g072990.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.49e-10101142344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +W++ E++l+v +  ++G g+W +Ia+ +  ++t+ q++s+ 
  Medtr8g072990.1 101 PWSQTEHDLFVMGLIKYGQGRWGKIAENFVCNKTPQQVQSYA 142
                      8*****************************899******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129312.48897150IPR017884SANT domain
TIGRFAMsTIGR015571.2E-798148IPR006447Myb domain, plants
SMARTSM007173.7E-798148IPR001005SANT/Myb domain
CDDcd001674.03E-8101142No hitNo description
PfamPF002492.1E-8101141IPR001005SANT/Myb domain
SuperFamilySSF466892.11E-10101149IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-8102148IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MPMETIDLTY FLDSPPSIPI SSSVAPMILN FDSTNPNLHH QHNTTFLGPS AQEHTHQSHQ  60
MITTNCPQTG THGGSLIARV LRPLPGSNTM PFPSGSRQMV PWSQTEHDLF VMGLIKYGQG  120
RWGKIAENFV CNKTPQQVQS YAASFFRHLP DEYVHGLKKR KYDFNGINSS SSASYYSMHN  180
MIANNDPAKE TLALFPIVPT YHEGEASRRN NTNNYEASTS MTLPSPSAGD GGVDLELRLG  240
LY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1568300.0AC156830.26 Medicago truncatula chromosome 8 clone mth2-151m10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003629087.10.0MYB-like DNA-binding domain, shaqkyf class protein
TrEMBLG7L8M90.0G7L8M9_MEDTR; MYB-like DNA-binding domain, shaqkyf class protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14942612
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-13Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]